DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG33689

DIOPT Version :9

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster


Alignment Length:139 Identity:27/139 - (19%)
Similarity:59/139 - (42%) Gaps:22/139 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QCGNFNRSYFSNFTMFVK-----NSQMNMEFFLLRVLVPGVTMDIEFFISMQNSYGFQKIF-QYT 89
            :||:.:.::......|:|     :..:::...|.::.:..:|:.   |..|::.:|::..| .||
  Fly    27 KCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITIS---FRLMRHDHGYKPFFIDYT 88

  Fly    90 LDMCSLLAQRRNNMFKKWFATFFDSGNFKKYCPVEPNFYYLKNYNYNTLFIPKFLYAGKYRVKFD 154
            .|.|..|..:::.:.|.::..:..|.|....||            |:...|...|:.|.....| 
  Fly    89 FDGCKFLRNQKHPIIKLFYKIYQGSSNINHTCP------------YDHDIIVDHLWTGNIESDF- 140

  Fly   155 MNQLRKIDG 163
            :..:..|:|
  Fly   141 LKYIPMING 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:461928 18/83 (22%)
CG33689NP_001027132.2 DUF1091 73..153 CDD:461928 20/90 (22%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.