DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG14492

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611275.2 Gene:CG14492 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster

Alignment Length:168 Identity:37/169 (22%)
Similarity:64/169 (38%) Gaps:50/169 (30%)


  Fly    29 ESQCGNF-------NRSYFSNFTMFV----KNSQMNMEF----------FLLRVLVPGVTMDIEF 72
            |.|..||       :.|....||..:    |....:|||          |.:::::|. ...:..
  Fly    33 ELQTDNFTCSSDDISSSVLKEFTCGISKSTKRRTWHMEFVLEQPVAEHDFFIKIVLPR-RRPLPD 96

  Fly    73 FISMQNSYGFQKIFQYTLDMCSLLAQRR--------NNMFKKWFATFFDSGNFKKYCPVEPNF-Y 128
            |:          :...|.|.|.|||.|.        .|:.:::       .||.|.||.:||| |
  Fly    97 FV----------LLNVTTDGCQLLANRNQVPLMRLGRNIMERF-------SNFPKQCPFKPNFTY 144

  Fly   129 YLKNYNYNTLFIPKFLYAGKYRVKFDMNQLRKIDGVRY 166
            |::.:..:...:|........:::|  :...|..|:|:
  Fly   145 YIRGFRLDLNLVPAVDMETPVQIEF--SHQNKQQGIRW 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 20/92 (22%)
CG14492NP_611275.2 DM8 95..186 CDD:214778 24/106 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.