DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG13193

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster

Alignment Length:173 Identity:43/174 (25%)
Similarity:74/174 (43%) Gaps:11/174 (6%)


  Fly     8 ISMSLICLIIVPIPTNKILLLESQCGNFNRSYFSNFT-MFVKNSQMNMEFFLLRVLVPGVTMDIE 71
            |.:.:..|...|...:|...:..:|   ::.|.|:.. ......::|::..|.|.|..|:...|.
  Fly    20 IQIQISALRFGPTLRSKFTNISVEC---SKDYCSSIRGWLTAKGELNLDIHLNRTLKNGLRTTIT 81

  Fly    72 FFISMQNSYGFQKIFQYTLDMCSLLAQ-RRNNMFKKWFATFFDSGNFKKYCPVEPNFYYLKNYNY 135
            ....:.....:|.:|.|.:|.|..|.: .::::.|.|....|..||....||::|..|.::|:..
  Fly    82 LLQLIDGKDRYQTLFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQPASYDVRNFQL 146

  Fly   136 NTLFIPKFLYAGKYRVKFDMNQLRKIDG-----VRYFLVGCAF 173
            ....||.:|.||.||: .|.|...|..|     |..|::...|
  Fly   147 ENHSIPGYLPAGFYRL-HDTNYYGKPKGRQRRPVATFILDIKF 188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 24/84 (29%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 29/93 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131062296
eggNOG 1 0.900 E1_2FAPI
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.