DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG13198

DIOPT Version :9

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster


Alignment Length:141 Identity:31/141 - (21%)
Similarity:65/141 - (46%) Gaps:22/141 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IPTNKILLLESQCGNFNRSYFSNFTMFVKNS-QMNMEFFLLRVLVPGVTMDIEFFISMQNSYGFQ 83
            :||::.|.....|         :..:..:|. :::::..|.::.:..:|..::.|   |...|::
  Fly    35 LPTSRGLTKYEYC---------HLKVVRRNQVELSLKVSLFQLPIRNLTTRLQCF---QRRDGYR 87

  Fly    84 KIFQYTL-DMCSLLAQRRNNM-FKKWFATFFDS----GNFKKYCPVEPNFYYLKNYNYNTLFIPK 142
            ....|.| |.|.|:|.|..:: |:::   .||:    .||.:.||.:.|...::.:..:...|..
  Fly    88 PFMYYILFDFCKLMASRNYDLSFERF---IFDAIRKQSNFNQTCPWKENHMTVEKFALDFTKISM 149

  Fly   143 FLYAGKYRVKF 153
            .:.||.||:.|
  Fly   150 PVPAGTYRLGF 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 22/88 (25%)
CG13198NP_610690.1 DM8 86..179 CDD:214778 21/78 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447826
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.