DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG12898

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_610581.1 Gene:CG12898 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster

Alignment Length:161 Identity:42/162 (26%)
Similarity:62/162 (38%) Gaps:44/162 (27%)


  Fly    28 LESQCGNFNRSYFSNFTMFVKNSQMNMEFFLLRVLVPGVTMDI--------EFFISMQNSYGFQK 84
            ||:.|.:....||..    |.|:::...|.::: |.|..|:||        ..|..|:|..|   
  Fly    15 LETNCDHDYVEYFRK----VPNTKLLYTFRVVK-LAPAFTIDITVKVVKTQRIFYKMENIKG--- 71

  Fly    85 IFQYTLDMCSLLAQRRNNMFKKWFATFFD----SGNFKKYCPVEPNFYYLKNYNYNTLFIPKFLY 145
                    |..|   .|.:..|.|...::    :|::.| ||::|..|||||.. ....||....
  Fly    72 --------CDFL---NNPLLFKMFGEVYNHLVVNGSYFK-CPIKPKVYYLKNEG-TVSIIPSIHP 123

  Fly   146 AGKY-----------RVKFDMNQLRKIDGVR 165
            .|::           |..|.|..|.|...||
  Fly   124 PGRFQLSMRVRMAESRAPFVMEMLWKYKIVR 154

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 25/106 (24%)
CG12898NP_610581.1 DUF1091 48..129 CDD:284008 25/97 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.