DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG33463

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_995846.1 Gene:CG33463 FlyBaseID:FBgn0053463 Length:157 Species:Drosophila melanogaster

Alignment Length:135 Identity:28/136 (21%)
Similarity:53/136 (39%) Gaps:30/136 (22%)


  Fly    36 NRSYFSNFTMFVKNSQMNMEFFLLRVLVPGVTMDIEFFISMQNSYGFQK-IFQYTLDMCSLLAQ- 98
            ||:|          ..::::..||::.|....::...|   |...|::. ::..|:|.|.|:.. 
  Fly    28 NRTY----------KYISVKLKLLQLPVTNAKVNGALF---QRHNGYKPFLYNITVDCCKLVKNP 79

  Fly    99 RRNNMFKKWFATFFDSGNFKKYCPVEPNFYYLK-----NYNYNTLFIP----------KFLYAGK 148
            :.:.:...:|.||.:..|....||...:....|     .|:..|..:|          .:..:|.
  Fly    80 KYSPVASYFFDTFKEFSNMNHSCPFNHDIILDKLTAKSVYHRMTNILPFPEGDYMLQLNWFTSGI 144

  Fly   149 YRVKF 153
            |||.|
  Fly   145 YRVIF 149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 20/100 (20%)
CG33463NP_995846.1 DUF1091 50..135 CDD:284008 17/88 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49221
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.