DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG33475

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_995799.1 Gene:CG33475 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster

Alignment Length:120 Identity:30/121 (25%)
Similarity:57/121 (47%) Gaps:22/121 (18%)


  Fly    47 VKNSQMNMEFFLLRVLVPGVTMDI---------EFFIS--MQNSYGFQKIFQY-TLDMCSLLAQR 99
            :|.::.|:::|   .||||.:..:         ..|:.  :||:...:.|:.. .|.:|:.|   
  Fly    10 LKYNRSNVDYF---GLVPGESQKMMINSTKLFKNIFLDNRIQNAVSNRTIYNIKNLAICNFL--- 68

  Fly   100 RNNMFKKWFATFFDS--GNFKKY-CPVEPNFYYLKNYNYNTLFIPKFLYAGKYRV 151
            .|.:..|.::..::.  ||...: |||:|:.|||.| :.....:|.|...|.:|:
  Fly    69 NNRLISKVYSVIYEGFVGNSTVFRCPVQPSVYYLSN-SVREFEVPIFHQPGMFRL 122

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 23/98 (23%)
CG33475NP_995799.1 DUF1091 54..122 CDD:284008 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.