DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG33483

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster

Alignment Length:156 Identity:33/157 (21%)
Similarity:61/157 (39%) Gaps:32/157 (20%)


  Fly    18 VPIPTNKILLL----ESQCGNFNRSYFSNFTMFVKNSQMNMEFFLLRV---LVPGVTMDIEFFIS 75
            :|:...||..|    ..:|.::::::.......:|:...:.::..|:|   .||...:.:.|  |
  Fly    64 IPVTKVKIASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNF--S 126

  Fly    76 MQNSYGFQKIFQY--TLDMCSLLAQRR-NNMFKKWFATFFDSGNFKKYCPVEPNFYYLKNYNYNT 137
            :...:...|.|.|  |:|.|..|...: |.:|..::..|....|....||.:.:           
  Fly   127 LLKRFNGYKPFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHD----------- 180

  Fly   138 LFIPKFLYAGKYRVKFDMNQLRKIDG 163
                  |...|....| |||  |::|
  Fly   181 ------LIVEKLPTNF-MNQ--KVNG 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 17/86 (20%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 23/98 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49177
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.