DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33766 and CG30050

Sequence 1:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_725159.2 Gene:CG30050 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster

Alignment Length:197 Identity:41/198 (21%)
Similarity:69/198 (35%) Gaps:65/198 (33%)


  Fly    12 LICLI-------IVPIPTNKILLLESQC-GNFNRSYFSNFTMFV---KNSQMNMEFFL------- 58
            ::|.:       ::|.....|.:.:..| ||.|  ||:|....:   ||..|.....:       
  Fly    11 IVCSLDTADTAKLIPNMGYYIEMKQMDCVGNPN--YFANLYCRIIPPKNRTMEASVNIMQQLSVF 73

  Fly    59 ---LRVLVPGVTMDIEFFISMQNSYGFQKIFQYTLDMCSLLAQR--------------RNNMFKK 106
               |||.:|.....|            .:||..|.|:|.:|.:|              :|:..|.
  Fly    74 SGSLRVSIPNAKKVI------------TQIFDITFDVCKVLRERKRKILIDLLVNTLAKNSNAKA 126

  Fly   107 WFATF----FDSGNFK--KYCPVEPNFYYLKNYNYNTLFIPKF-------LYAGKYRVKFDMNQL 158
            |...|    |:|.|..  ...|:.....:..|.::   ||||.       |:...:.:..:.|:.
  Fly   127 WRCPFPKGKFESRNISVTDLPPMLTESEFFVNLDF---FIPKVAIAMNVTLHGHLFEIAKERNRR 188

  Fly   159 RK 160
            :|
  Fly   189 KK 190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 22/110 (20%)
CG30050NP_725159.2 DM8 90..177 CDD:214778 21/90 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.