DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and Slc25a39

DIOPT Version :8

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_080818.1 Gene:Slc25a39 / 68066 MGIID:1196386 Length:359 Species:Mus musculus

Alignment Length:412 Identity:133/413 (32%)
Similarity:197/413 (48%) Gaps:93/413 (23%)


  Fly    43 IKPMQQVVSALVGGLITTFVVTPLEVVKTRVQTQH--AIRQRPTVSKL----------------- 88
            |.|:||:|::..|.::|:..:|||:|||.|:|:|.  |..:..|.|:.                 
Mouse     9 ISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPSATSELTTPSRFWSLSYTKSSSALQSPGK 73

  Fly    89 CYVYHNGLM--THVCRSSDICVPKPGRDPQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSA 151
            |.:|.||::  .::|.:...|... .:||..   ..|.:|||||||...|...||:||..|||..
Mouse    74 CLLYCNGVLEPLYLCPNGTRCATW-FQDPTR---FTGTLDAFVKIVRHEGTRTLWSGLPATLVMT 134

  Fly   152 LPSTIIYFLTYEYIKNSLSHIYLVSQKFEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTAS 216
            :|:|.|||..|:.:|     .:|..|..                                  |:.
Mouse   135 VPATAIYFTAYDQLK-----AFLCGQSL----------------------------------TSD 160

  Fly   217 LPYYVPMASGICSRTIVVTAITPIEMVRIKMQSEYMTYAELWRVLRSLIRQHGILGLWRGWPPTV 281
            |  |.||.:|..:|...||.::|:|:||.|:|:::::|.||...:::.:.|.|...||.||.||.
Mouse   161 L--YAPMVAGALARMGTVTVVSPLELVRTKLQAQHVSYRELASSVQAAVTQGGWRSLWLGWGPTA 223

  Fly   282 MRDAPFSGTYWAVYEAIKRAFSVTEP----TFLFSFLTGAISGAVATFVTMPFDLITTHTQIELG 342
            :||.|||..||..||.:|...|...|    :...||:.|.|||.||..:|:|||::.|..|:.| 
Mouse   224 LRDVPFSALYWFNYELVKSWLSGLRPKDQTSVGISFVAGGISGMVAATLTLPFDVVKTQRQMSL- 287

  Fly   343 QDVLYEEIGAGTGAGTGTGAGARPKTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRV 407
                            |.....|.|.|:.      .|....:|:|....|.|||:.|.:||:::.
Mouse   288 ----------------GAVEAVRVKPPRV------DSTWLLLRRIRAESGTRGLFAGFLPRIIKA 330

  Fly   408 VPACAIMISTFEYSKSFFFHYN 429
            .|:|||||||:|:.||||...|
Mouse   331 APSCAIMISTYEFGKSFFQRLN 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 50/149 (34%)
Mito_carr 216..302 CDD:278578 35/86 (41%)
Mito_carr 306..429 CDD:278578 43/127 (34%)
Slc25a39NP_080818.1 Mito_carr 9..152 CDD:278578 50/152 (33%)
Solcar 1 9..151 50/151 (33%)
Solcar 2 159..243 35/86 (41%)
Mito_carr 161..246 CDD:278578 36/87 (41%)
Mito_carr 251..350 CDD:278578 42/122 (34%)
Solcar 3 253..347 40/117 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0761
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001348
OrthoInspector 1 1.000 T130986
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45760
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.870

Return to query results.
Submit another query.