| Sequence 1: | NP_608327.2 | Gene: | Tyler / 3772349 | FlyBaseID: | FBgn0031038 | Length: | 441 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_061331.2 | Gene: | SLC25A40 / 55972 | HGNCID: | 29680 | Length: | 338 | Species: | Homo sapiens |
| Alignment Length: | 418 | Identity: | 139/418 - (33%) |
|---|---|---|---|
| Similarity: | 209/418 - (50%) | Gaps: | 103/418 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 38 DPRYR------IKPMQQVVSALVGGLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGL 96
Fly 97 MTHVCRSSDIC--------VPKPGRDPQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALP 153
Fly 154 STIIYFLTYEYIKNSLSHIYLVSQKFEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLP 218
Fly 219 YYVPMASGICSRTIVVTAITPIEMVRIKMQSEYMTYAELWRVLRSLIRQHGILGLWRGWPPTVMR 283
Fly 284 DAPFSGTYWAVYEAIKR----AFSVTEPTFLFSFLTGAISGAVATFVTMPFDLITTHTQIELGQD 344
Fly 345 VLYEEIGAGTGAGTGTGAGARPKTPQSAVANSRPSVLSR---MRQIYRLQGVRGLYVGVMPRMLR 406
Fly 407 VVPACAIMISTFEYSKSFFFHYNLDLQE 434 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tyler | NP_608327.2 | Mito_carr | 41..171 | CDD:278578 | 53/143 (37%) |
| Mito_carr | 216..302 | CDD:278578 | 37/89 (42%) | ||
| Mito_carr | 306..429 | CDD:278578 | 43/125 (34%) | ||
| SLC25A40 | NP_061331.2 | Mito_carr | 12..136 | CDD:278578 | 52/167 (31%) |
| Solcar 1 | 13..131 | 51/132 (39%) | |||
| Solcar 2 | 139..223 | 38/95 (40%) | |||
| Mito_carr | 145..228 | CDD:278578 | 36/82 (44%) | ||
| Mito_carr | 231..330 | CDD:278578 | 43/124 (35%) | ||
| Solcar 3 | 233..327 | 40/119 (34%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 89 | 1.000 | Domainoid score | I7833 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG0761 | |
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 291 | 1.000 | Inparanoid score | I2798 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG53824 | |
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0001594 | |
| OrthoInspector | 1 | 1.000 | - | - | mtm8620 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR45760 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X1001 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 11 | 10.930 | |||||