DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and SLC25A40

DIOPT Version :8

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_061331.2 Gene:SLC25A40 / 55972 HGNCID:29680 Length:338 Species:Homo sapiens

Alignment Length:418 Identity:139/419 (33%)
Similarity:209/419 (50%) Gaps:103/419 (25%)


  Fly    38 DPRYR------IKPMQQVVSALVGGLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGL 96
            ||..|      :.|:||::::..|.::|:.:||||:|||.|:|.|:    .|.....|:||.|||
Human     2 DPETRGQEIIKVTPLQQMLASCTGAILTSVIVTPLDVVKIRLQAQN----NPLPKGKCFVYSNGL 62

  Fly    97 MTHVCRSSDIC--------VPKPGRDPQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALP 153
            |.|:|    :|        ..|||.       .:|.:|||.||:...|...||:||.||||.|:|
Human    63 MDHLC----VCEEGGNKLWYKKPGN-------FQGTLDAFFKIIRNEGIKSLWSGLPPTLVMAVP 116

  Fly   154 STIIYFLTYEYIKNSLSHIYLVSQKFEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLP 218
            :|:|||..|:.:...|                             ::..|.|.:.          
Human   117 ATVIYFTCYDQLSALL-----------------------------RSKLGENETC---------- 142

  Fly   219 YYVPMASGICSRTIVVTAITPIEMVRIKMQSEYMTYAELWRVLRSLIRQHGILGLWRGWPPTVMR 283
              :|:.:||.:|...||.|:|:|::|.||||:..:|.||.|.:...:.:.|.:.|||||.|||:|
Human   143 --IPIVAGIVARFGAVTVISPLELIRTKMQSKKFSYVELHRFVSKKVSEDGWISLWRGWAPTVLR 205

  Fly   284 DAPFSGTYWAVYEAIKR----AFSVTEPTFLFSFLTGAISGAVATFVTMPFDLITTHTQIELGQD 344
            |.|||..||..||.:|:    ...:.||||:.:|.:||:||:.|...|:|||::.|..|.:|.  
Human   206 DVPFSAMYWYNYEILKKWLCEKSGLYEPTFMINFTSGALSGSFAAVATLPFDVVKTQKQTQLW-- 268

  Fly   345 VLYEEIGAGTGAGTGTGAGARPKTPQSAVANSRPSVLSR---MRQIYRLQGVRGLYVGVMPRMLR 406
             .||                       :...|.|..:|.   |:.|....|..||:.|::||:::
Human   269 -TYE-----------------------SHKISMPLHMSTWIIMKNIVAKNGFSGLFSGLIPRLIK 309

  Fly   407 VVPACAIMISTFEYSKSFFFHYNLDLQE 434
            :.|||||||||:|:.|:||...|:..|:
Human   310 IAPACAIMISTYEFGKAFFQKQNVRRQQ 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 53/144 (37%)
Mito_carr 216..302 CDD:278578 37/90 (41%)
Mito_carr 306..429 CDD:278578 43/126 (34%)
SLC25A40NP_061331.2 Mito_carr 12..136 CDD:278578 52/168 (31%)
Solcar 1 13..131 51/133 (38%)
Solcar 2 139..223 38/96 (40%)
Mito_carr 145..228 CDD:278578 36/83 (43%)
Mito_carr 231..330 CDD:278578 43/125 (34%)
Solcar 3 233..327 40/120 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0761
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001348
OrthoInspector 1 1.000 T130218
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45760
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.