DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and Dic2

DIOPT Version :8

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_732512.1 Gene:Dic2 / 42423 FlyBaseID:FBgn0038797 Length:304 Species:Drosophila melanogaster

Alignment Length:403 Identity:76/404 (19%)
Similarity:128/404 (32%) Gaps:144/404 (36%)


  Fly    55 GGL---ITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICVPKPGRDPQ 116
            |||   :...|..|::::|..:|||        ..||...                        |
  Fly    22 GGLASSMAAMVTHPIDLIKVLIQTQ--------AEKLSVF------------------------Q 54

  Fly   117 NLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVSQKFEE 181
            ..|          |||...|...::.|:|.:::.....|:..|           .||.|      
  Fly    55 TTR----------KIVKEQGPLAMYNGISASMLRQYTYTLARF-----------GIYSV------ 92

  Fly   182 SGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIV------VTAITPI 240
                       |...:|.:|                     ||...|...|.      |.|  |.
  Fly    93 -----------GSGAMDTST---------------------MAGKTCLAAIAGGIGGFVGA--PA 123

  Fly   241 EMVRIKMQSEYMTYAELWRVLRSLI-------RQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAI 298
            :::.:::|::.....|..|..:..|       |:.|...|:.|.....:|.|..:....|.||..
  Fly   124 DLINVRLQNDVKLPPEKRRNYKHAIDGLVRITREEGWKNLFNGSSMIALRGAFMTVGQIAFYEQS 188

  Fly   299 K-RAFSVTEPTFLFSF-LTGAISGAVATFVTMPFDLITTHTQIELGQDVLYEEIGAGTGAGTGTG 361
            | :...:..|.::.:: |...||..|||.:|.|.|::.|            ..:.|..|..:|.|
  Fly   189 KSQMIKLGMPDYMGTYILASMISSVVATTLTQPIDVVKT------------RRMNAAPGEYSGLG 241

  Fly   362 AGARPKTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMISTFEYSKSFFF 426
                    ...|..|:             :|....:.|.:|.:.|::|...::....||.::.|.
  Fly   242 --------DVFVKTSK-------------EGPLAFFKGYVPSLSRLLPHTVLLFLGLEYLRTHFG 285

  Fly   427 HYNLDLQEAAYRR 439
            :.....|..|:.|
  Fly   286 YLPEPKQTGAFYR 298

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 21/119 (18%)
Mito_carr 216..302 CDD:278578 21/100 (21%)
Mito_carr 306..429 CDD:278578 25/124 (20%)
Dic2NP_732512.1 Mito_carr 22..90 CDD:278578 22/121 (18%)
Mito_carr 98..194 CDD:278578 23/119 (19%)
Mito_carr 198..285 CDD:278578 25/120 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1999257
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.