DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and Slc25a40

DIOPT Version :8

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:XP_017176412.1 Gene:Slc25a40 / 319653 MGIID:2442486 Length:409 Species:Mus musculus

Alignment Length:433 Identity:139/434 (32%)
Similarity:214/434 (49%) Gaps:107/434 (25%)


  Fly    27 PLRLTTLILSADPRYRIK----------------PMQQVVSALVGGLITTFVVTPLEVVKTRVQT 75
            |.||........||:::|                |:||::::..|.::|:.:||||:|||.|:|.
Mouse    54 PARLAETRALQSPRHQLKSMEPETEGPPPTIPVTPLQQMIASCTGAVLTSLMVTPLDVVKIRLQA 118

  Fly    76 QHAIRQRPTVSKLCYVYHNGLMTHVC----RSSDICVPKPGRDPQNLRPLRGAMDAFVKIVCTSG 136
            |:    .|.....|::|.||||.|:|    .|......|||.       .||.:|||:||:...|
Mouse   119 QN----NPFPKGKCFLYSNGLMDHMCVCEEESKKAWYKKPGN-------FRGTLDAFLKILRNEG 172

  Fly   137 FSGLWAGLSPTLVSALPSTIIYFLTYE----YIKNSLSHIYLVSQKFEESGMKDQVPGADGGDPL 197
            ...||:||.||||.|:|:|:|||..||    ::|..|.                           
Mouse   173 IKSLWSGLPPTLVMAIPATVIYFTCYEQLSAFLKTKLG--------------------------- 210

  Fly   198 DQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVTAITPIEMVRIKMQSEYMTYAELWRVLR 262
            :..||                  :|:.:|:.:|...||.|:|:|::|.|:||:..:|.||::.:.
Mouse   211 ENETR------------------IPIVAGVVARFGAVTVISPLELIRTKVQSKKFSYKELYQFVS 257

  Fly   263 SLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAIKR----AFSVTEPTFLFSFLTGAISGAVA 323
            ..:.:.|.:.||:||.||::||.|||..||..||.:||    ...:.||||:.:|.:||:||:.|
Mouse   258 MRVSEDGWISLWKGWAPTILRDVPFSAMYWYNYENLKRWLCEKSGLYEPTFMINFTSGALSGSFA 322

  Fly   324 TFVTMPFDLITTHTQIELGQDVLYEEIGAGTGAGTGTGAGARPKTPQSAVANSRPSVLSRMRQIY 388
            ...|:|||::.|..|.:|..:. |.:..|.....|.|                      .|:.|.
Mouse   323 AVATLPFDVVKTQKQTQLWTNE-YCKFPAPLDMSTWT----------------------IMKNIV 364

  Fly   389 RLQGVRGLYVGVMPRMLRVVPACAIMISTFEYSKSFFFHYNLD 431
            ..:|..||:.|::||::::|||||||||::|..||||...|::
Mouse   365 ADKGFSGLFTGLIPRLVKIVPACAIMISSYELGKSFFQKQNVE 407

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 55/154 (36%)
Mito_carr 216..302 CDD:278578 33/90 (37%)
Mito_carr 306..429 CDD:278578 43/123 (35%)
Slc25a40XP_017176412.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0761
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001348
OrthoInspector 1 1.000 T130986
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45760
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.870

Return to query results.
Submit another query.