DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and Slc25a40

DIOPT Version :9

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001276524.1 Gene:Slc25a40 / 319653 MGIID:2442486 Length:337 Species:Mus musculus


Alignment Length:405 Identity:134/405 - (33%)
Similarity:207/405 - (51%) Gaps:91/405 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PRYRIKPMQQVVSALVGGLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVC-- 101
            |...:.|:||::::..|.::|:.:||||:|||.|:|.|:    .|.....|::|.||||.|:|  
Mouse    10 PTIPVTPLQQMIASCTGAVLTSLMVTPLDVVKIRLQAQN----NPFPKGKCFLYSNGLMDHMCVC 70

  Fly   102 --RSSDICVPKPGRDPQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYE- 163
              .|......|||.       .||.:|||:||:...|...||:||.||||.|:|:|:|||..|| 
Mouse    71 EEESKKAWYKKPGN-------FRGTLDAFLKILRNEGIKSLWSGLPPTLVMAIPATVIYFTCYEQ 128

  Fly   164 ---YIKNSLSHIYLVSQKFEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMAS 225
               ::|..|.                           :..||                  :|:.:
Mouse   129 LSAFLKTKLG---------------------------ENETR------------------IPIVA 148

  Fly   226 GICSRTIVVTAITPIEMVRIKMQSEYMTYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGT 290
            |:.:|...||.|:|:|::|.|:||:..:|.||::.:...:.:.|.:.||:||.||::||.|||..
Mouse   149 GVVARFGAVTVISPLELIRTKVQSKKFSYKELYQFVSMRVSEDGWISLWKGWAPTILRDVPFSAM 213

  Fly   291 YWAVYEAIKR----AFSVTEPTFLFSFLTGAISGAVATFVTMPFDLITTHTQIELGQDVLYEEIG 351
            ||..||.:||    ...:.||||:.:|.:||:||:.|...|:|||::.|..|.:|..:. |.:..
Mouse   214 YWYNYENLKRWLCEKSGLYEPTFMINFTSGALSGSFAAVATLPFDVVKTQKQTQLWTNE-YCKFP 277

  Fly   352 AGTGAGTGTGAGARPKTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMIS 416
            |.....|.|                      .|:.|...:|..||:.|::||::::|||||||||
Mouse   278 APLDMSTWT----------------------IMKNIVADKGFSGLFTGLIPRLVKIVPACAIMIS 320

  Fly   417 TFEYSKSFFFHYNLD 431
            ::|..||||...|::
Mouse   321 SYELGKSFFQKQNVE 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 54/137 (39%)
Mito_carr 216..302 CDD:278578 33/89 (37%)
Mito_carr 306..429 CDD:278578 43/122 (35%)
Slc25a40NP_001276524.1 Mito_carr 14..135 CDD:365909 52/131 (40%)
Solcar 1 14..132 52/128 (41%)
Solcar 2 140..224 34/101 (34%)
Mito_carr 146..225 CDD:365909 32/78 (41%)
Mito_carr 234..331 CDD:365909 42/119 (35%)
Solcar 3 234..328 39/116 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7902
eggNOG 1 0.900 - - E1_KOG0761
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 294 1.000 Inparanoid score I2730
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53824
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001594
OrthoInspector 1 1.000 - - mtm8854
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45760
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1001
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.