DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tyler and SPBP23A10.06

DIOPT Version :8

Sequence 1:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_595818.1 Gene:SPBP23A10.06 / 2541312 PomBaseID:SPBP23A10.06 Length:335 Species:Schizosaccharomyces pombe

Alignment Length:440 Identity:124/441 (28%)
Similarity:190/441 (43%) Gaps:135/441 (31%)


  Fly     9 MENGGEEEGCRLECKEMDPLRLTTLILSADPRYRIKPMQQVVSALVGGLITTFVVTPLEVVKTRV 73
            |:.|...||...:           |.::|:|  .:||:.:::||.||.:|||..||||:|||||:
pombe     1 MQIGAATEGVEAD-----------LSVNAEP--DVKPIAKMLSACVGSVITTLTVTPLDVVKTRL 52

  Fly    74 QTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICVPKPGRDPQNLRPLRGAMDAFVKIVCTSGFS 138
            |:: :|.|..:             |....|:.|.    |:.....:||.|.:....:|....|..
pombe    53 QSE-SISQYSS-------------TQPISSAKIL----GKGRPAPKPLGGPVSGLYQIARHEGVR 99

  Fly   139 GLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVSQKFEESGMKDQVPGADGGDPLDQATRG 203
            .||.||.|:|...||:..:.||.||    .|..:|                 :|.|.|       
pombe   100 SLWRGLVPSLTMLLPANTVQFLGYE----QLLPLY-----------------SDWGFP------- 136

  Fly   204 INVSATAPVSTASLPYYVPMASGICSRTIVVTAITPIEMVRIKMQSEYMTYA---------ELWR 259
                |.|.::.||            :|||..|.::|||:.|.::|:....|.         |::.
pombe   137 ----AAAAIAGAS------------ARTISATIVSPIELFRTRVQAVGGHYPPGHAREIANEVFD 185

  Fly   260 VLRSLIRQHGILGLWRGWPPTVMRDAPFSGTYWAVYEAIK---------RAFSVTEPT--FLFSF 313
            .|:.:|.|.|||.||.|...|:.||.|||..||..||.|:         :|||.::.|  ...:|
pombe   186 GLKLMIHQKGILNLWSGVSVTLWRDVPFSAFYWWSYERIRLFLLGHPSLQAFSSSQSTKDLYINF 250

  Fly   314 LTGAISGAVATFVTMPFDLITTHTQIELGQDVLYEEIGAGTGAGTGTGAGARPKTPQSAVANSRP 378
            ::|.|||.:||.:|.|||:..|..|:                                     ..
pombe   251 VSGGISGTLATLLTQPFDVSKTAKQV-------------------------------------HG 278

  Fly   379 SVLSR---MRQIYRLQGVRGLYVGVMPRMLRVVPACAIMISTFEYSKSFF 425
            ..|:|   |..:::..|.:.|:.|.:||.::|.|:||||||::..:|.:|
pombe   279 HTLTRGQFMLTLWKRGGPKALWKGTLPRCVKVAPSCAIMISSYHLTKKYF 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 43/130 (33%)
Mito_carr 216..302 CDD:278578 33/104 (32%)
Mito_carr 306..429 CDD:278578 32/126 (25%)
SPBP23A10.06NP_595818.1 Mito_carr 21..132 CDD:278578 44/150 (29%)
Mito_carr 148..231 CDD:278578 30/83 (36%)
Mito_carr 242..331 CDD:278578 32/125 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I1207
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001348
OrthoInspector 1 1.000 T631597
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45760
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
88.030

Return to query results.
Submit another query.