DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA46a and CheA75a

DIOPT Version :9

Sequence 1:NP_001027399.1 Gene:CheA46a / 3772338 FlyBaseID:FBgn0262594 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_649035.2 Gene:CheA75a / 40011 FlyBaseID:FBgn0036783 Length:184 Species:Drosophila melanogaster


Alignment Length:184 Identity:45/184 - (24%)
Similarity:85/184 - (46%) Gaps:25/184 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLVLSIAHSALVRAGLECRIESISKVFGDNETLFEFN-FRVIGRQRLLNGTLNFHVDL-DDDYE 70
            ::::|.:..........|...|.:....||::||..|: .:.|||:|.|||:..|..:: :||::
  Fly     6 IIVLLQLLEKIKCEQSYEVTNERLEPFEGDSQTLVLFDGLKTIGRERALNGSFKFLGEMNNDDFK 70

  Fly    71 MSNEVLALKDGEWE---------STSVSARFKTCKYMAVIYDKYFAVSFK---DSNIP-KGTEAC 122
            :|.|:.:..:|:.|         .||:      |:.....|.::...|.|   .:|.| ...:.|
  Fly    71 VSVELYSSPNGDGEFKRMVMDVPQTSI------CECFKKFYVQFVQPSLKTGETTNFPVVDDDFC 129

  Fly   123 PIKKGEYYARNVEVIADNWAHYAKLGLVRSNMLVRKNNVVYGGFDIVLVLSQKI 176
            |:.:||:|.:||.:...:|......|:|::.:.........||    |::..||
  Fly   130 PVPEGEFYVKNVILNTQDWPSQVPRGIVKAIITFFSGGKNVGG----LIVEVKI 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA46aNP_001027399.1 DUF1091 88..>154 CDD:301369 16/69 (23%)
CheA75aNP_649035.2 DM8 85..180 CDD:214778 23/105 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459057
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I7631
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116828at33392
OrthoFinder 1 1.000 - - FOG0009966
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.