DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA46a and CheA56a

DIOPT Version :9

Sequence 1:NP_001027399.1 Gene:CheA46a / 3772338 FlyBaseID:FBgn0262594 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001027438.1 Gene:CheA56a / 3772206 FlyBaseID:FBgn0262595 Length:180 Species:Drosophila melanogaster


Alignment Length:170 Identity:59/170 - (34%)
Similarity:89/170 - (52%) Gaps:2/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVLSIAHSALVRAGLECRIESISKVFGDNETLFEFNFRVIGRQRLLNGTLNFHVDLDDDYEMSN 73
            ||:|........::..|.|.|||..|.|..||||.:..|::||.|::||||.|..|||:.:::..
  Fly    10 LLILWTVSVGSKKSNYEVRFESIDAVKGSTETLFLYQLRLLGRNRMINGTLIFLEDLDETFDVLF 74

  Fly    74 EVLALKDGEWESTSV-SARFKTCKYMAVIYDKYFAVSFKDSNIP-KGTEACPIKKGEYYARNVEV 136
            |..|.|:|.|....| :|..|.|::....|..:|.|...:||:| .|.|.||.:||.|:.:|..|
  Fly    75 ESHAFKNGYWVKGIVNAAASKPCEFFNRYYISFFLVKSTESNLPTTGAEMCPFRKGTYFVKNGVV 139

  Fly   137 IADNWAHYAKLGLVRSNMLVRKNNVVYGGFDIVLVLSQKI 176
            ..::|......||.|..:...||....||..:.:.:::.|
  Fly   140 STEDWPPIVFKGLNRFTISYLKNGECVGGVQLTISIAEII 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA46aNP_001027399.1 DUF1091 88..>154 CDD:301369 23/67 (34%)
CheA56aNP_001027438.1 DUF1091 97..179 CDD:301369 24/81 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459054
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I7631
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116828at33392
OrthoFinder 1 1.000 - - FOG0009966
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.