DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CheA46a and CheA56a

Sequence 1:NP_001027399.1 Gene:CheA46a FlyBaseID:FBgn0262594 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001027438.1 Gene:CheA56a FlyBaseID:FBgn0262595 Length:180 Species:Drosophila melanogaster

Alignment Length:170 Identity:59/171 (35%)
Similarity:89/171 (52%) Gaps:2/171 (1%)


  Fly     9 LLVLSIAHSALVRAGLECRIESISKVFGDNETLFEFNFRVIGRQRLLNGTLNFHVDLDDDYEMSN 73
            ||:|........::..|.|.|||..|.|..||||.:..|::||.|::||||.|..|||:.:::..
  Fly    10 LLILWTVSVGSKKSNYEVRFESIDAVKGSTETLFLYQLRLLGRNRMINGTLIFLEDLDETFDVLF 74

  Fly    74 EVLALKDGEWESTSV-SARFKTCKYMAVIYDKYFAVSFKDSNIP-KGTEACPIKKGEYYARNVEV 136
            |..|.|:|.|....| :|..|.|::....|..:|.|...:||:| .|.|.||.:||.|:.:|..|
  Fly    75 ESHAFKNGYWVKGIVNAAASKPCEFFNRYYISFFLVKSTESNLPTTGAEMCPFRKGTYFVKNGVV 139

  Fly   137 IADNWAHYAKLGLVRSNMLVRKNNVVYGGFDIVLVLSQKI 176
            ..::|......||.|..:...||....||..:.:.:::.|
  Fly   140 STEDWPPIVFKGLNRFTISYLKNGECVGGVQLTISIAEII 179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CheA46aNP_001027399.1 DUF1091 88..>154 CDD:301369 23/68 (34%)
CheA56aNP_001027438.1 DUF1091 97..179 CDD:301369 24/82 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131042616
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21112
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.