DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CheA46a and CheA86a

Sequence 1:NP_001027399.1 Gene:CheA46a FlyBaseID:FBgn0262594 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001027174.1 Gene:CheA86a FlyBaseID:FBgn0261291 Length:189 Species:Drosophila melanogaster

Alignment Length:171 Identity:51/172 (30%)
Similarity:84/172 (49%) Gaps:9/172 (5%)


  Fly     6 HKVLLVLSIAHSALVRAGLECRIESISKVFGDNETLFEF-NFRVIGRQRLLNGTLNFHVDLDDD- 68
            :.||::|......|::|.:......:|....:|...|:. |.|:|||:|:||||.....||||: 
  Fly     4 YTVLVLLIGIPKLLLQAQMSYEAIFVSVTSEENSKPFDLSNLRLIGRERILNGTFEILEDLDDEH 68

  Fly    69 YEMSNEVLA--LKDGEWESTSVSA-RFKTCKYMAVIYDKYFAVSFK---DSNIPKGTEACPIKKG 127
            :::|.|:..  .:||.::...:|. |...|.:... |..||....|   ::::...|.:|...||
  Fly    69 FQISVEIYTNPARDGNYKLLPMSVPRQGVCTFFKK-YGFYFRDCIKNGINTDLFLNTTSCLFPKG 132

  Fly   128 EYYARNVEVIADNWAHYAKLGLVRSNMLVRKNNVVYGGFDI 168
            .||.:||.:...||....:.||.|......||||..|.:::
  Fly   133 HYYLKNVTINVQNWPKIMQRGLCRHIAFFYKNNVPMGSYNL 173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CheA46aNP_001027399.1 DUF1091 88..>154 CDD:301369 20/70 (29%)
CheA86aNP_001027174.1 DUF1091 <126..174 CDD:301369 17/49 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131042759
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21112
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.