DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CheA46a and CheA84a

Sequence 1:NP_001027399.1 Gene:CheA46a FlyBaseID:FBgn0262594 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001027150.1 Gene:CheA84a FlyBaseID:FBgn0261290 Length:180 Species:Drosophila melanogaster

Alignment Length:173 Identity:51/174 (29%)
Similarity:85/174 (49%) Gaps:10/174 (6%)


  Fly     8 VLLVLSIAHSALVRAGLECRIESISKVFGDNETLFEFN-FRVIGRQRLLNGTLNFHVDLDDD-YE 70
            ||::|.....||:....|.|..||:   .:...||:|: .|.:||:|:.|||.....|||:: :.
  Fly     8 VLIMLIGKTCALIPRTYETRFISIT---SNGTNLFDFSQIRFLGRERMANGTFELKEDLDNESFS 69

  Fly    71 MSNEVL--ALKDGEWESTSVSARFKTCKYMAVIYDKYFAVSFK---DSNIPKGTEACPIKKGEYY 130
            :..|..  ::.|||::....:|..::.......|..||..|.|   .::.|..|..||:.||.||
  Fly    70 VVGETFIDSVGDGEYKQLPFTAPKQSVCTALKAYWSYFEPSIKYGVKTDFPAHTHPCPLPKGIYY 134

  Fly   131 ARNVEVIADNWAHYAKLGLVRSNMLVRKNNVVYGGFDIVLVLS 173
            .::|.:..|||......|.:::...:.||:...|..:||..:|
  Fly   135 IKDVVLKNDNWPVIMPRGYLKAVANLFKNDEYGGSLEIVSQIS 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CheA46aNP_001027399.1 DUF1091 88..>154 CDD:301369 19/69 (28%)
CheA84aNP_001027150.1 DUF1091 <124..153 CDD:284008 11/29 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131042747
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21112
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.