DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CheA46a and CG18540

Sequence 1:NP_001027399.1 Gene:CheA46a FlyBaseID:FBgn0262594 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_611316.2 Gene:CG18540 FlyBaseID:FBgn0034326 Length:190 Species:Drosophila melanogaster

Alignment Length:111 Identity:23/112 (21%)
Similarity:46/112 (41%) Gaps:29/112 (26%)


  Fly    24 LECRIESISKVFGDNETLFEFNFRVIGRQRLLNGTLNFHVDLDDDYEMSNEVLALKDG---EWES 85
            :..|||.||:        .||.|         :||..:::|:||...:...:|:...|   :::.
  Fly    47 MNLRIERISR--------SEFGF---------SGTFFWNIDVDDSVMVEMRILSSYSGDESDYKL 94

  Fly    86 TSVSARFKTCKYMAVIYDKYFAVSFKDSNIPK--GTEACPIKKGEY 129
            |.:|.:.:.       :.:|....:||..:|.  .....|:.:.|:
  Fly    95 TPMSIQPQK-------FTEYVNTFYKDLLLPNLGNCTDLPVYENEF 133

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CheA46aNP_001027399.1 DUF1091 88..>154 CDD:301369 7/45 (16%)
CG18540NP_611316.2 DUF1091 88..164 CDD:284008 8/54 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131043041
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21112
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.