DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CheA46a and CG18539

Sequence 1:NP_001027399.1 Gene:CheA46a FlyBaseID:FBgn0262594 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_611315.3 Gene:CG18539 FlyBaseID:FBgn0034325 Length:185 Species:Drosophila melanogaster

Alignment Length:66 Identity:15/67 (22%)
Similarity:32/67 (48%) Gaps:4/67 (6%)


  Fly    21 RAGLECRIESISKV-FGDNETLFEFNFRV--IGR-QRLLNGTLNFHVDLDDDYEMSNEVLALKDG 81
            :||.....|.:|.. :..:|:|.:...::  :|| ....:.||:::.|:|.|..:..:|.....|
  Fly    20 KAGRNWEYEPLSLTSYSSDESLLKITTKIDRLGRSDYAFSMTLDWNYDVDKDTMVEADVHHCSSG 84

  Fly    82 E 82
            :
  Fly    85 D 85

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CheA46aNP_001027399.1 DUF1091 88..>154 CDD:301369
CG18539NP_611315.3 DUF1091 85..162 CDD:284008 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131043120
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21112
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.