powered by:
                   
 
    
    
             
          
            Protein Alignment CheA46a and CG18538
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001027399.1 | Gene: | CheA46a / 3772338 | FlyBaseID: | FBgn0262594 | Length: | 177 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_611314.2 | Gene: | CG18538 / 37095 | FlyBaseID: | FBgn0034324 | Length: | 182 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 189 | Identity: | 39/189 - (20%) | 
          
            | Similarity: | 64/189 -  (33%) | Gaps: | 71/189 - (37%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     1 MSLELHKVLLVLSIAHSALVRAGLECRIESISKVFGDNETLFEFNFRVIGRQRLLNGTLNFHVDL 65:|:|.|.       :..:|::  |:.:||.|             |..|.|....|:||.   :.|
 Fly    24 ISIETHS-------SDESLIK--LDMKIERI-------------NRGVFGLTPRLSGTT---IRL 63
 
 
  Fly    66 DDDYEMSNEVLALKDGE--------WESTSVSARFKTCKYMAVIYDK----YFAVSFKD----SN 114...:.:...||....|:        |.....|           :|:.    |..||.|:    ||
 Fly    64 MKPWYVEANVLRSSTGDVSDYKLLPWAIPKQS-----------LYEHLNTYYKDVSMKNFKHCSN 117
 
 
  Fly   115 IP--KGTEACPIKKGEYYARNVEVIADNWAHYAKLGLVRSNMLVRKNNVVYGGFDIVLV 171||  :|....|:.|..|:.....:..|        ||         ..:|..||.::::
 Fly   118 IPQFEGKFQPPLPKQTYFGNKCVIDGD--------GL---------PEIVPAGFYLIVI 159
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 1 | 0.930 | - | - |  | C45459107 | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR21112 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 3 | 2.940 |  | 
        
      
           
             Return to query results.
             Submit another query.