DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA46a and CG18536

DIOPT Version :9

Sequence 1:NP_001027399.1 Gene:CheA46a / 3772338 FlyBaseID:FBgn0262594 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_611312.1 Gene:CG18536 / 37093 FlyBaseID:FBgn0034322 Length:191 Species:Drosophila melanogaster


Alignment Length:175 Identity:37/175 - (21%)
Similarity:56/175 - (32%) Gaps:62/175 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DNETLFEFNFRVIGRQRLLNGTLNFHVDLDDDYEMSNEVLALKDGEWESTSVSAR---------- 91
            :::..||.....:||               .||.:| .:|..|....|.|.|.|:          
  Fly    43 ESKLKFEAKIERLGR---------------SDYGLS-AILEWKYDTNEETMVEAQAYRSNSGDES 91

  Fly    92 -FKTCKYMAV----IYDKYFAVSFKD---------SNIPKGTEAC--PIKKGEYYARNVEVIADN 140
             :|...: |:    .|| |....:||         ||:||..:..  |..|..|.....::..|.
  Fly    92 DYKLLPW-AIPKQPFYD-YINTYYKDVISKNLGYCSNLPKYEDKFQPPWPKNTYKLDKCKIGGDG 154

  Fly   141 WAHYAKLGLVRSNMLVRKNNVVY---------GGFDIVLVLSQKI 176
            ....|..|..:         :|:         .||..|..|:.||
  Fly   155 LPEIAPPGFYK---------IVFTKFGPGQPTWGFTAVFKLTNKI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA46aNP_001027399.1 DUF1091 88..>154 CDD:301369 19/91 (21%)
CG18536NP_611312.1 DUF1091 89..166 CDD:284008 17/87 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459108
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.