DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA46a and CheA29a

DIOPT Version :9

Sequence 1:NP_001027399.1 Gene:CheA46a / 3772338 FlyBaseID:FBgn0262594 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_788004.1 Gene:CheA29a / 246659 FlyBaseID:FBgn0053194 Length:180 Species:Drosophila melanogaster


Alignment Length:173 Identity:59/173 - (34%)
Similarity:89/173 - (51%) Gaps:11/173 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLLVLSIAHSALVRAGLEC-------RIESISKVFGDNETLFEFNFRVIGRQRLLNGTLNFHVD 64
            ||.|:|.......:    .|       |.|||:.:.|:.||||..:.|::||:|:|||::...||
  Fly     7 KVFLILWTVSQVYI----PCWGKKFISRFESINGIEGEKETLFTCSVRLVGRERMLNGSIMHQVD 67

  Fly    65 LDDDYEMSNEVLALKDGEWESTSVSARFKTCKYMAVIYDKYFAVSFKDSNIPKGTEACPIKKGEY 129
            |||.:::..::|..|:|||...::..|.|.|.:....:.|||....||||:|...|.|...||||
  Fly    68 LDDSFDVWMDILHFKNGEWAQGNIKVRTKPCDWFTNYFGKYFLPLVKDSNLPPIQEMCVFPKGEY 132

  Fly   130 YARNVEVIADNWAHYAKLGLVRSNMLVRKNNVVYGGFDIVLVL 172
            |.|..::...||......||.:.|:...::....||...|:.|
  Fly   133 YLRITKIEPQNWPPILYRGLNQFNINYVRDGKSTGGIQFVIDL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA46aNP_001027399.1 DUF1091 88..>154 CDD:301369 23/65 (35%)
CheA29aNP_788004.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459055
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I7631
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116828at33392
OrthoFinder 1 1.000 - - FOG0009966
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.