DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10731 and Dmac2

DIOPT Version :9

Sequence 1:NP_001027422.1 Gene:CG10731 / 3772305 FlyBaseID:FBgn0034081 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001277416.1 Gene:Dmac2 / 66349 MGIID:1913599 Length:258 Species:Mus musculus


Alignment Length:184 Identity:50/184 - (27%)
Similarity:87/184 - (47%) Gaps:22/184 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NQVDAERLS------KVGANRLCAEWIIKNGGGVRFVESPSRLWKDYNSLPGENTQFC------- 84
            ::|:.|..|      |.|.....|.:|:|.||.|:|.:      |:....|...:.|.       
Mouse    65 SKVNRENRSFTNIQEKYGPYVAGAVFILKQGGAVKFQD------KEEWIRPNNRSHFLAEIQKFQ 123

  Fly    85 ---IKVVDASNSSIMKIGLEHLKDCRSIDTVIFHNCKHLENDGLEGLHHISSSLQRLQVSGCYNI 146
               ::.||||..:|...||.:|...:.:.::....|.:|::..|..|:.::.|||.|.::||..|
Mouse   124 NVPVEAVDASGCAINYQGLSNLLPLKELRSLSLQRCPNLDDWCLSRLYLLAGSLQELSLAGCPRI 188

  Fly   147 TDSGLAVIGELKNLRQLLIFDMIFVKNMEAVAASLKKQLPSCDIKATKMGLTLK 200
            ::.|||.:..|:|||:|.|.|:..|.:.......:::.||.|::........||
Mouse   189 SERGLACLHHLQNLRRLDISDLPAVSHPGLTQILVEEMLPHCEVLGADWAQNLK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10731NP_001027422.1 AMN1 <91..167 CDD:187754 25/75 (33%)
leucine-rich repeat 109..134 CDD:275381 4/24 (17%)
leucine-rich repeat 135..159 CDD:275381 10/23 (43%)
Dmac2NP_001277416.1 leucine-rich repeat 127..140 CDD:275381 5/12 (42%)
AMN1 149..>221 CDD:187754 22/71 (31%)
leucine-rich repeat 151..176 CDD:275381 4/24 (17%)
leucine-rich repeat 177..201 CDD:275381 10/23 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4273
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.