DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10731 and dmac2l

DIOPT Version :8

Sequence 1:NP_001027422.1 Gene:CG10731 / 3772305 FlyBaseID:FBgn0034081 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001017243.1 Gene:dmac2l / 549997 XenbaseID:XB-GENE-978777 Length:199 Species:Xenopus tropicalis

Alignment Length:174 Identity:53/175 (30%)
Similarity:96/175 (55%) Gaps:5/175 (3%)


  Fly    22 RGIWGYVAVAFNQVDAERLSKVGANRLCAEWIIKNGGGVRFVESPSRLWKDYNSLP-GENTQFCI 85
            |..||::...||:||.||:...|.:|..:||:::.|..||: :...|..:|||.|| |...:|.|
 Frog    23 RYFWGWLNAVFNKVDYERIKDFGPDRAASEWLLRCGAHVRY-KGFERWQQDYNGLPTGPLGKFKI 86

  Fly    86 KVVDASNSSIMKIGLEHLKDCRSIDTVIFHNCKHLENDGLE---GLHHISSSLQRLQVSGCYNIT 147
            :.::|::|.||..|.:||.....::.:....|.::|:..||   .:.::.:||:||::..|.|:|
 Frog    87 QAINATDSCIMYRGFDHLDGLEHVEEIKLCKCIYIEDTCLERMSKIENLQNSLRRLEIISCGNVT 151

  Fly   148 DSGLAVIGELKNLRQLLIFDMIFVKNMEAVAASLKKQLPSCDIK 191
            |.|:..:..|:||..|.:.|:..:...:.....|:...||..::
 Frog   152 DRGIIALNTLRNLEYLFLSDLPGITKKQTTVEMLQTANPSLHVE 195

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10731NP_001027422.1 AMN1 <91..167 CDD:187754 23/79 (29%)
leucine-rich repeat 109..134 CDD:275381 4/28 (14%)
leucine-rich repeat 135..159 CDD:275381 9/24 (38%)
dmac2lNP_001017243.1 leucine-rich repeat 110..137 CDD:275381 4/27 (15%)
leucine-rich repeat 139..163 CDD:275381 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C187697120
eggNOG 1 0.900 E1_KOG3864
Hieranoid 1 1.000
Homologene 1 1.000 H12232
Inparanoid 1 1.050 99 1.000 Inparanoid score I4760
OMA 1 1.010
OrthoDB 1 1.010 D1395428at2759
OrthoFinder 1 1.000 FOG0006362
OrthoInspector 1 1.000 T1058344
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4273
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.