DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10731 and C05C8.1

DIOPT Version :8

Sequence 1:NP_001027422.1 Gene:CG10731 / 3772305 FlyBaseID:FBgn0034081 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_504842.1 Gene:C05C8.1 / 179119 WormBaseID:WBGene00015460 Length:200 Species:Caenorhabditis elegans

Alignment Length:195 Identity:59/195 - (30%)
Similarity:96/195 - (49%) Gaps:18/195 - (9%)


  Fly     9 RITQLLARDPKDQRGIWG--YVAVAFNQVDAERLSKVGANRLCAEWIIKNGGGVRFVESPSRLWK 71
            :.||.|.     |..|.|  :|...||..|.:|:.:|||:|..||||::.||.::| ...:..::
 Worm     9 KFTQALG-----QHNIPGLRWVLEGFNNYDVQRVKEVGADRAAAEWIVRCGGSIKF-NQIAETFE 67

  Fly    72 DYNSLPGENTQF---------CIKVVDASNSSIMKIGLEHLKDCRSIDTVIFHNCKHLENDGLEG 127
            |||.|.....|.         .::.:.|.|:|:...|..|.:....|.:|.|..||:|.:.|||.
 Worm    68 DYNCLVKRTAQLDPRLSQDNVTLETIRAVNASVTGFGCRHFEGLTGIKSVYFIKCKNLHDFGLEY 132

  Fly   128 L-HHISSSLQRLQVSGCYNITDSGLAVIGELKNLRQLLIFDMIFVKNMEAVAASLKKQLPSCDIK 191
            : :|:...|:.|.:..|..||:.||..:.:...|.:|::.::..|...|.|...|:..||..||:
 Worm   133 MGNHVGGHLKTLHIEECRRITEFGLEHLTKFSALDKLVLRNLKSVHGKEKVQEKLRGALPKTDIQ 197

  Fly   192  191
             Worm   198  197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10731NP_001027422.1 AMN1 <91..167 CDD:187754 23/76 (30%)
leucine-rich repeat 109..134 CDD:275381 10/25 (40%)
leucine-rich repeat 135..159 CDD:275381 7/23 (30%)
C05C8.1NP_504842.1 leucine-rich repeat 90..113 CDD:275381 5/22 (23%)
leucine-rich repeat 141..165 CDD:275381 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C187690751
eggNOG 1 0.900 E1_KOG3864
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I3641
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1395428at2759
OrthoFinder 1 1.000 FOG0006362
OrthoInspector 1 1.000 T475531
orthoMCL 1 0.900 OOG5_135015
Panther 1 1.100 LDO PTHR13382
Phylome 1 0.910 0.824 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4273
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.