DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10731 and dmac2

DIOPT Version :8

Sequence 1:NP_001027422.1 Gene:CG10731 / 3772305 FlyBaseID:FBgn0034081 Length:203 Species:Drosophila melanogaster
Sequence 2:XP_012824506.1 Gene:dmac2 / 100485450 XenbaseID:XB-GENE-6045848 Length:248 Species:Xenopus tropicalis

Alignment Length:161 Identity:46/161 - (28%)
Similarity:80/161 - (49%) Gaps:14/161 - (8%)


  Fly    38 ERLSKVGANRLCAEWIIKNGGGVRF--------VESPSRLWKDYNSLPGENTQFCIKVVDASNSS 94
            |||  .|.....|.:.:...|||||        .:...:...|:.    |:.:..::.:|.|.|.
 Frog    74 ERL--YGKYVAAAYYTLSQRGGVRFQGHKDWYRADRRGKFSWDFL----EHKEVPVECIDLSRSP 132

  Fly    95 IMKIGLEHLKDCRSIDTVIFHNCKHLENDGLEGLHHISSSLQRLQVSGCYNITDSGLAVIGELKN 159
            :...||:::...:.:..:..:||.||::..|..||....||:.|.::||.:||:.|||.:..|:|
 Frog   133 LTFRGLDNIVSLKELRELYLNNCPHLDDWALSRLHVFKDSLEVLSIAGCPSITERGLATLHHLQN 197

  Fly   160 LRQLLIFDMIFVKNMEAVAASLKKQLPSCDI 190
            ||.|.:.|:..|.|...:...:::.||.|:|
 Frog   198 LRYLDLSDLSSVTNKGLIRILMEEVLPKCEI 228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10731NP_001027422.1 AMN1 <91..167 CDD:187754 26/75 (35%)
leucine-rich repeat 109..134 CDD:275381 7/24 (29%)
leucine-rich repeat 135..159 CDD:275381 10/23 (43%)
dmac2XP_012824506.1 AMN1 <123..185 CDD:187754 17/61 (28%)
leucine-rich repeat 123..146 CDD:275381 5/22 (23%)
leucine-rich repeat 147..172 CDD:275381 7/24 (29%)
leucine-rich repeat 173..197 CDD:275381 10/23 (43%)
leucine-rich repeat 198..218 CDD:275381 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3864
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.