DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10731 and dmac2

DIOPT Version :10

Sequence 1:NP_001027422.1 Gene:CG10731 / 3772305 FlyBaseID:FBgn0034081 Length:203 Species:Drosophila melanogaster
Sequence 2:XP_004917157.1 Gene:dmac2 / 100485450 XenbaseID:XB-GENE-6045848 Length:396 Species:Xenopus tropicalis


Alignment Length:60 Identity:17/60 - (28%)
Similarity:28/60 - (46%) Gaps:4/60 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 WGYVAVAFNQVDAERLSKVGANRLC--AEWIIKNGGGVRFVESPSRLWKDYNSLPGENTQ 82
            |.::...||....::|....|...|  |::|:|....| ||.:| .:.::...|.|..||
 Frog   210 WDFLDTFFNLTLKDQLFLGWARLRCSGAKYILKGDDDV-FVRTP-EIVQELTLLGGHQTQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10731NP_001027422.1 leucine-rich repeat 109..134 CDD:275381
leucine-rich repeat 135..159 CDD:275381
dmac2XP_004917157.1 Galactosyl_T 159..347 CDD:473923 17/60 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.