DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and lbp-5

DIOPT Version :10

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_491928.1 Gene:lbp-5 / 191700 WormBaseID:WBGene00002257 Length:136 Species:Caenorhabditis elegans


Alignment Length:129 Identity:55/129 - (42%)
Similarity:79/129 - (61%) Gaps:11/129 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLG 67
            ||| ::||.:||||::|:||:||||:.||...:..||:|:.:.|:.:.:...||||.:.:.|.||
 Worm     6 FVG-RWKLVESENFEDYLKEVGVGLLLRKAACAAKPTLEIKVNGNKWHVNQLSTFKNTTLEFTLG 69

  Fly    68 VEFDEETLDGRNVKSIITLDGNKLTQEQK----GDKPTTIVREFTDNELITLIPHLTPSQHGSL 127
            |||||.|.|||..||.||::..|:...||    .|..:.|.|.|...:|||.:      |.||:
 Worm    70 VEFDETTPDGRQFKSTITIEDGKVVHVQKRIKDSDHDSVITRWFEGEKLITTL------QSGSV 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 FABP_pancrustacea 2..116 CDD:381252 52/116 (45%)
lbp-5NP_491928.1 FABP 5..135 CDD:381183 55/129 (43%)

Return to query results.
Submit another query.