DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and Fabp6

DIOPT Version :10

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_032401.1 Gene:Fabp6 / 16204 MGIID:96565 Length:128 Species:Mus musculus


Alignment Length:109 Identity:31/109 - (28%)
Similarity:55/109 - (50%) Gaps:11/109 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTT-STFKTSAISF 64
            |:|.| ||:.:..:|:||:||.||:.....:.|.:.....||..:|..:|.:.: |.....:..|
Mouse     1 MAFSG-KYEFESEKNYDEFMKRLGLPGDVIERGRNFKIITEVQQDGQDFTWSQSYSGGNIMSNKF 64

  Fly    65 KLGVEFDEETLDGRNVKSIITLDGNKL---------TQEQKGDK 99
            .:|.|.:.:|:.|:..|:.:.::|.|:         |.|..|||
Mouse    65 TIGKECEMQTMGGKKFKATVKMEGGKVVAEFPNYHQTSEVVGDK 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 FABP_pancrustacea 2..116 CDD:381252 30/108 (28%)
Fabp6NP_032401.1 Lipocalin 1..128 CDD:473899 31/109 (28%)

Return to query results.
Submit another query.