DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33695 and C17orf49

DIOPT Version :9

Sequence 1:NP_001027248.1 Gene:CG33695 / 3772186 FlyBaseID:FBgn0052831 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001136270.1 Gene:C17orf49 / 124944 HGNCID:28737 Length:192 Species:Homo sapiens


Alignment Length:131 Identity:59/131 - (45%)
Similarity:82/131 - (62%) Gaps:29/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NSAIKVGEIFTAAGQAFSRLGDLTMQLHPNAE-SPSG-KWTDEEIDMLHSSIMRFSDDLTKISLS 64
            :::.||||||:|||.||::||:|||||||.|: ||:| |||:.||:||.:::.||.|||..||..
Human     3 SASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAKWTETEIEMLRAAVKRFGDDLNHISCV 67

  Fly    65 IKNRTVSQIRQALKKKAFEDAGIPAKQVPVQQVQHVLQTLPQQQPQQ------------PLQQPP 117
            ||.|||:||:..:|:|.:||:|||               ||.:.|::            |...||
Human    68 IKERTVAQIKATVKRKVYEDSGIP---------------LPAESPKKGPKKVASGVLSPPPAAPP 117

  Fly   118 P 118
            |
Human   118 P 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33695NP_001027248.1 SANT 37..75 CDD:197842 22/38 (58%)
SANT 38..75 CDD:238096 21/36 (58%)
C17orf49NP_001136270.1 Myb_DNA-binding 41..77 CDD:365977 20/35 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006351
OrthoInspector 1 1.000 - - oto90388
orthoMCL 1 0.900 - - OOG6_108312
Panther 1 1.100 - - LDO PTHR21397
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3404
SonicParanoid 1 1.000 - - X5305
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.