DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33784 and CG33632

Sequence 1:NP_001027169.1 Gene:CG33784 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster

Alignment Length:183 Identity:61/184 (33%)
Similarity:97/184 (53%) Gaps:22/184 (12%)


  Fly     8 IRLWSYVVINLL----LSDSNALFKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKL 68
            |:|...|...|:    |::..:|.:|.||:|...:|.|...:.|.|:.:.|....::|..::.|:
  Fly     3 IKLKLCVAFQLICIYYLTEVYSLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKI 67

  Fly    69 PIKSTTCVLTLFRRFSGYRPFLFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDI 133
            |:........|::|.:||:|||:|:|:|.|.|||.|...|.|...|:..|.:||:|||||:|||:
  Fly    68 PVTKIKVQFGLYKRLNGYKPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDL 132

  Fly   134 IVNQM---VLNDDMISKAPVPNGFYKLRFIVKTDGVWRGEVEVHAEVNLGIDR 183
            ::::|   .:|..:....|.|.|.|||              ||| .:...|||
  Fly   133 VLDEMSYHSINYKLTEILPFPEGNYKL--------------EVH-WIAYDIDR 170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 36/81 (44%)
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 36/85 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C295567
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.