DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33784 and CG33721

Sequence 1:NP_001027169.1 Gene:CG33784 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001036743.1 Gene:CG33721 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster

Alignment Length:175 Identity:43/176 (24%)
Similarity:91/176 (52%) Gaps:5/176 (3%)


  Fly     9 RLWSYVVINLLLSDSNALFKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLPIKST 73
            :|:..|:....:.::.:..:|.|.||...:.::...:.|.:|.:.|....::|.|.:|::||.:.
  Fly     7 KLFVLVIFFGNIMENASKLEFTNFKCHVKDPTYLSFEYCFIKSVNRTYKYISLKANMYEVPITNA 71

  Fly    74 TCVLTLFRRFSGYRPFLFNVTVDVCHFLKHRKRY--PFADLVYDGIKSFSNLNHTCPFNHDIIVN 136
            :..|.:.|||..|.|.....::|||.::.::|..  |...|..:..|.::|.||.||::||:|::
  Fly    72 SAKLQISRRFRSYMPITIAASIDVCKYMAYKKNLANPMLRLFEEITKKYTNTNHKCPYDHDLIID 136

  Fly   137 QM---VLNDDMISKAPVPNGFYKLRFIVKTDGVWRGEVEVHAEVN 178
            ::   .|::...:..|:|.|.|....|..:..:.|..:.::..|:
  Fly   137 RLPSKYLSEHFTNILPLPPGDYSFNSIWYSRNIERATISIYYTVS 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 25/83 (30%)
CG33721NP_001036743.1 DUF1091 74..160 CDD:284008 26/86 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.