DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33784 and CG13589

Sequence 1:NP_001027169.1 Gene:CG33784 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster

Alignment Length:152 Identity:49/153 (32%)
Similarity:76/153 (50%) Gaps:21/153 (14%)


  Fly    14 VVINLLLSDSNALFKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLPIKSTTCVLT 78
            |::..|:.....|.|..|..|..|.||:..:..|.||...|....||::|...: |.|:....:.
  Fly    12 VILGFLVCGEAPLAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIE-PAKNIYLHMK 75

  Fly    79 LFRRFSGYRPFLFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFN--------HDIIV 135
            :.::.:||:||||:.|.|.|.|:: |:..|||.:|::.||:.|.:|||||:.        |.|.|
  Fly    76 MMKKANGYKPFLFDYTFDACEFMR-RRNQPFAKIVWNMIKNVSTVNHTCPYEGLQMLSDFHHIDV 139

  Fly   136 NQMVLNDDMISKAPVPNGFYKL 157
                       ..|:|:|.|.|
  Fly   140 -----------PVPLPSGDYLL 150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 30/86 (35%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 30/81 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C283286
eggNOG 1 0.900 E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.