DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33784 and CG33919

Sequence 1:NP_001027169.1 Gene:CG33784 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027393.1 Gene:CG33919 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster

Alignment Length:147 Identity:35/148 (24%)
Similarity:78/148 (53%) Gaps:7/148 (5%)


  Fly    20 LSDSNALFKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLPIKSTTCVLTLFRR-F 83
            |:::..::|.|.::|.........:. |.:|.:...:..:|:...:. :|:.:....:.:|.: :
  Fly    17 LTNTQLVYKLKKIECLVNRTRVSNVS-CHVKAINWNLAVVNMDCFMI-VPLHNPIIRMQVFTKDY 79

  Fly    84 SG-YRPFLFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQMVLNDDMISK 147
            |. |:|||.:|.:.:|..::.|...|:..:::...|.::|:||:|||:..:|.....|:..::  
  Fly    80 SNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHLIARDGFLDTSLL-- 142

  Fly   148 APVPNGFYKLRFIVKTD 164
            .|.|.|||::..:| ||
  Fly   143 PPFPQGFYQVSLVV-TD 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 24/80 (30%)
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 24/84 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C282480
eggNOG 1 0.900 E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.