DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33784 and CG33658

Sequence 1:NP_001027169.1 Gene:CG33784 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027209.1 Gene:CG33658 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster

Alignment Length:148 Identity:52/149 (35%)
Similarity:79/149 (53%) Gaps:14/149 (9%)


  Fly    28 KFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLPIKSTTCVLTLFRRFSGYRPFLFN 92
            :|.|.|||...|...:::.|.||.:.|....|:...:|.|| :.|......|.::.:||:|||:|
  Fly    29 EFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKL-LNSLKVNFGLHQQINGYKPFLYN 92

  Fly    93 VTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQM---VLNDDMISKAPVPNGF 154
            :|:|.|.|:|:.|....|...||.|::.|||||:||:|||||:.::   .:|..:....|.|.|.
  Fly    93 ITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTSETINSRLPKTLPFPTGN 157

  Fly   155 Y----------KLRFIVK 162
            |          |.|.:.|
  Fly   158 YMFQTYWIANEKYRVVTK 175

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 35/91 (38%)
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 33/76 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C293833
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.