DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33784 and CG33679

Sequence 1:NP_001027169.1 Gene:CG33784 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027273.1 Gene:CG33679 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster

Alignment Length:173 Identity:69/174 (40%)
Similarity:99/174 (57%) Gaps:8/174 (5%)


  Fly    10 LWSYVVINLL-LSDSNALFKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLPIKST 73
            ||    |:|| :.:|:...:..|:||..|:|||.....|.||||||||:|.|:|.::.||||...
  Fly     5 LW----ISLLFIGESHGYVRLTNLKCESYDKSFVVFPECRLKVLGRGIIGANIHVKLLKLPINRM 65

  Fly    74 TCVLTLFRRFSGYRPFLFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQM 138
            ......:|:.:||.||||||:.:.|..|::..|.......|.....|||:|||||:|.||.:...
  Fly    66 VVRFITYRKLNGYHPFLFNVSEEHCRVLRYPNRLRVFYYFYTAFMPFSNINHTCPYNDDIYIRNC 130

  Fly   139 VLNDDMISKAPVPNGFYKLRFIVKTDGV--WRGEVEVHAEVNL 179
            .|:|.|.:|.|:|.|.|||. :...|||  |...:.:|.|:::
  Fly   131 TLDDRMFAKVPLPKGSYKLT-LEMDDGVVNWISIINIHFEIDV 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 33/78 (42%)
CG33679NP_001027273.1 DUF1091 70..149 CDD:284008 33/79 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C279532
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.