DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33784 and CG33758

DIOPT Version :9

Sequence 1:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster


Alignment Length:168 Identity:47/168 - (27%)
Similarity:83/168 - (49%) Gaps:19/168 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLLSDSNALFKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKL--PIKSTTCVLTLF 80
            |:|:.:....|||::.|..:::.|.|...|:||.:.|....:::.   |||  |:......|..|
  Fly    10 LVLTSTEVEAKFKSLHCAAFDQDFGEFLLCKLKAISRLRNSISVQ---YKLKQPVSKIFIRLEFF 71

  Fly    81 RRFSGYRPFLFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQMVLNDD-- 143
            :|.:|:||||:|.|.::|.||. |.......:.|..::.:...|::|||.  :|.|:::...|  
  Fly    72 KRANGWRPFLYNFTANLCDFLA-RNNNVIMGIGYAYLRPYLVKNYSCPFK--VIENELLECKDFE 133

  Fly   144 -----MISKAPVPNGFY--KLRFIVKTDGVW--RGEVE 172
                 :.::.|:..|.|  :|.||.|.....  .|.:|
  Fly   134 LDINNLRNRFPIETGEYALQLTFIAKNKAALTINGSIE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 24/86 (28%)
CG33758NP_001027397.1 DUF1091 66..152 CDD:284008 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.