DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33784 and CG33766

Sequence 1:NP_001027169.1 Gene:CG33784 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027140.1 Gene:CG33766 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster

Alignment Length:121 Identity:25/122 (20%)
Similarity:45/122 (37%) Gaps:21/122 (17%)


  Fly    59 LNLHAQVYKLPIKSTTCVLTLFRRFSGYRPF--LFNVTVDVCHFLKHRKRYPFAD---LVYDGIK 118
            :|:...:.::.:...|..:..|........|  :|..|:|:|..|..|:...|..   ..:|.  
  Fly    52 MNMEFFLLRVLVPGVTMDIEFFISMQNSYGFQKIFQYTLDMCSLLAQRRNNMFKKWFATFFDS-- 114

  Fly   119 SFSNLNHTCPFNHDIIVNQMVLNDDMISKAPVPN----GFYKLRF----IVKTDGV 166
              .|....||    :..|...|.:...:...:|.    |.|:::|    :.|.|||
  Fly   115 --GNFKKYCP----VEPNFYYLKNYNYNTLFIPKFLYAGKYRVKFDMNQLRKIDGV 164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 18/87 (21%)
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 18/91 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49155
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.