DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33784 and CG33777

Sequence 1:NP_001027169.1 Gene:CG33784 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027108.1 Gene:CG33777 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster

Alignment Length:131 Identity:49/132 (37%)
Similarity:75/132 (57%) Gaps:3/132 (2%)


  Fly    28 KFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLPIKSTTCVLTLFRRFSGYRPFLFN 92
            ||.|:|||..:..|..:..|.||.:.|....|:|...:.:.|:.........::|::||:|.|:|
  Fly    19 KFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKPVSRIKVNAATWKRYNGYKPSLYN 83

  Fly    93 VTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQM---VLNDDMISKAPVPNGF 154
            .|||.|.|:|:.|..|.|..:|...|.:||:|:|||||.|.||.::   .:|:.:.|..|||:|.
  Fly    84 FTVDACKFIKNPKSNPVAHYIYRLFKDYSNVNYTCPFNDDAIVEKLPISFVNNQVTSVLPVPSGD 148

  Fly   155 Y 155
            |
  Fly   149 Y 149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 35/81 (43%)
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 35/79 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C292535
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.