DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33784 and CG33626

Sequence 1:NP_001027169.1 Gene:CG33784 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027405.2 Gene:CG33626 FlyBaseID:FBgn0053626 Length:167 Species:Drosophila melanogaster

Alignment Length:153 Identity:30/154 (19%)
Similarity:60/154 (39%) Gaps:14/154 (9%)


  Fly    30 KNVKCTCYE----KSFCELKRCELKVLGRGIVGLNLHAQVYKLPIKSTTCVLTLFRRFSGYRPFL 90
            :.::..|::    ..:.:...|::....|.::.:.|........||....:.|.|:..:.||.| 
  Fly    16 RRLRWDCFDCQMGPHYADQMTCQIGGTRRSLLNVELKLLTELDQIKVYIKISTRFKSTTLYRKF- 79

  Fly    91 FNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQMVLNDDMISKAPVPNG-- 153
            |::|.|.|..:....:......:::.:...||....||.|...|....:..:|.:... ||:.  
  Fly    80 FDITFDGCRVISDMVQGTMVSNMFNAVVKSSNQPRKCPVNKGTIYYHNISIEDALPMF-VPSAQL 143

  Fly   154 -----FYKLRFIVKTDGVWRGEV 171
                 ||..|.:.....: |||:
  Fly   144 FIQIDFYARRQLYLNVSL-RGEI 165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 19/85 (22%)
CG33626NP_001027405.2 DUF1091 62..140 CDD:284008 18/80 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.