DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33784 and CG33770

Sequence 1:NP_001027169.1 Gene:CG33784 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027144.2 Gene:CG33770 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster

Alignment Length:90 Identity:23/91 (25%)
Similarity:37/91 (41%) Gaps:16/91 (18%)


  Fly    90 LFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQMVLNDDMISKAPVP--- 151
            ||:.::|||:.:...|...|... |..:..:.|....||.|    .:...|.|....:..||   
  Fly    91 LFSTSIDVCNIVNAAKINLFKKW-YKNLLKYGNFLRQCPLN----ASHYYLRDWQFGEGLVPPFI 150

  Fly   152 -NGFYKL---RFIVKTDGVWRGEVE 172
             :|.|:|   .|.    |.::|:.|
  Fly   151 TSGSYRLETYNFF----GKYKGKDE 171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 18/71 (25%)
CG33770NP_001027144.2 DM8 88..178 CDD:214778 23/91 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49525
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.