DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33784 and CG33770

DIOPT Version :10

Sequence 1:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster


Alignment Length:90 Identity:23/90 - (25%)
Similarity:37/90 - (41%) Gaps:16/90 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQMVLNDDMISKAPVP--- 151
            ||:.::|||:.:...|...|... |..:..:.|....||.|    .:...|.|....:..||   
  Fly    91 LFSTSIDVCNIVNAAKINLFKKW-YKNLLKYGNFLRQCPLN----ASHYYLRDWQFGEGLVPPFI 150

  Fly   152 -NGFYKL---RFIVKTDGVWRGEVE 172
             :|.|:|   .|.    |.::|:.|
  Fly   151 TSGSYRLETYNFF----GKYKGKDE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 76..157 CDD:461928 18/70 (26%)
CG33770NP_001027144.2 DM8 88..178 CDD:214778 23/90 (26%)

Return to query results.
Submit another query.