DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33784 and CG33648

Sequence 1:NP_001027169.1 Gene:CG33784 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster

Alignment Length:169 Identity:50/170 (29%)
Similarity:97/170 (57%) Gaps:4/170 (2%)


  Fly    14 VVINLLLSDSNALFKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLPIKSTTCVLT 78
            :|:.|...:..::.:|.|:||:..:.|:...:.|.:|.:.|....:::::::..||:.:.|..:.
  Fly    10 IVVILYGINDVSIVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPLTNATINVA 74

  Fly    79 LFRRFSGYRPFLFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNL-NHTCPFNHDIIVNQMV--- 139
            |::|::||:|||:||:||.|.||:.:|.......::|.|...||: :.|||||..|.|:::.   
  Fly    75 LYKRYNGYKPFLYNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFNSFISVDKLTTNF 139

  Fly   140 LNDDMISKAPVPNGFYKLRFIVKTDGVWRGEVEVHAEVN 178
            ||:.:....|||.|.|...|...:..::|..|.|:..::
  Fly   140 LNNKLTQVLPVPEGDYLFAFRWFSYNIYRSSVNVYITIS 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 33/82 (40%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 33/86 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C290721
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.