DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33784 and CG33792

Sequence 1:NP_001027169.1 Gene:CG33784 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster

Alignment Length:204 Identity:43/205 (21%)
Similarity:77/205 (38%) Gaps:45/205 (22%)


  Fly    12 SYVVINLLLSDSNAL-------FKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLP 69
            |.|.:.:||...|.:       ||.:..:|......|..:. |.||.:......||:...: |..
  Fly     9 SCVYLGVLLCLPNTIFYSNGYFFKIRKTECIANGAYFSNVS-CILKPVNWTRSVLNMDGDI-KEA 71

  Fly    70 IKSTTCVLTLFRRFSG--YRPFLFNVTVDVCHFLKHR------KRYPFADLVYDGIKSFSNLNHT 126
            :......:.:|.:.|.  |:||......|||..||::      ::|..:.|.     .::|:||:
  Fly    72 LTDIKMSVEVFYKDSSNLYKPFAVKFKFDVCQLLKNKTQSNFLQKYAISHLT-----EWTNVNHS 131

  Fly   127 CPFNHDIIVNQMV---------------------LNDDMISKAPVPNGFYKLRFIVK--TDGVWR 168
            ||:...:.:..:|                     ...|.:|...:|...||:.|...  ..|:..
  Fly   132 CPYRVSLCIYNIVKFSQYIEYIYMFLKGHLIARNFRLDEVSLPILPIQDYKIAFNFSGANPGIHL 196

  Fly   169 GEVEVHAEV 177
            |.|.::.|:
  Fly   197 GLVLIYFEI 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 23/107 (21%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:284008 23/106 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.