DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33784 and CG33783

Sequence 1:NP_001027169.1 Gene:CG33784 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027168.1 Gene:CG33783 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster

Alignment Length:163 Identity:121/164 (74%)
Similarity:142/164 (87%) Gaps:7/164 (4%)


  Fly    28 KFK-------NVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLPIKSTTCVLTLFRRFSG 85
            |||       |:|||||||||||||||||||||||||||.||||.::|||.|:||:|:|:|||:|
  Fly     2 KFKTNPIGVVNIKCTCYEKSFCELKRCELKVLGRGIVGLFLHAQAHQLPINSSTCILSLYRRFNG 66

  Fly    86 YRPFLFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQMVLNDDMISKAPV 150
            |||||:|:|||:|.|.|:||||||.|||||.||:|||:||:||.|||||||:|||||:||.|.|.
  Fly    67 YRPFLYNMTVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPHNHDIIVNRMVLNDNMIVKVPF 131

  Fly   151 PNGFYKLRFIVKTDGVWRGEVEVHAEVNLGIDR 183
            |:|||||.||:||||:|||||||:.|||||.||
  Fly   132 PSGFYKLMFILKTDGIWRGEVEVYVEVNLGYDR 164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 58/78 (74%)
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 58/78 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C278965
eggNOG 1 0.900 E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.