DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33784 and CG33703

Sequence 1:NP_001027169.1 Gene:CG33784 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027119.1 Gene:CG33703 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster

Alignment Length:170 Identity:47/171 (27%)
Similarity:75/171 (44%) Gaps:3/171 (2%)


  Fly     9 RLWSYVVINLLLSD--SNALFKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNL-HAQVYKLPI 70
            :|.|.|:..|::.|  ...:|:...::|...:.||...|.|::.....|...|.: ...:||.||
  Fly     4 QLLSLVLPLLIILDCSQGRVFRVSKMECRSLDPSFTYFKTCKVVRRENGRAALYVSEVFLYKDPI 68

  Fly    71 KSTTCVLTLFRRFSGYRPFLFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIV 135
            ......|.:||.....|....|.|:|.|.|.:......|...:...:...||||.|||...:|..
  Fly    69 DDIVLNLGVFRIAKNRRFQFLNETLDYCLFSRQYLASGFFGFLMTPLLRISNLNATCPLQQNITF 133

  Fly   136 NQMVLNDDMISKAPVPNGFYKLRFIVKTDGVWRGEVEVHA 175
            |...::::.|.:.|:|||.|...........||.:|:|:|
  Fly   134 NGFSVDENTIKEIPIPNGVYMFHLRSSLMKKWRTDVKVYA 173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 24/78 (31%)
CG33703NP_001027119.1 DUF1091 73..155 CDD:284008 25/82 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.