DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33784 and CG33642

DIOPT Version :10

Sequence 1:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster


Alignment Length:132 Identity:33/132 - (25%)
Similarity:53/132 - (40%) Gaps:27/132 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LFKFKNVKC-TCYEKSFCELKRCELKV----------LGRGIVGLNLHAQVY-KLPIKS------ 72
            |..|.|..| .|.|:|| .:|..|..|          :...||.||..:.|. ::.:||      
  Fly    12 LLWFTNHICLKCEERSF-RIKMNEFAVKYKMRDLIQHIDFRIVNLNNRSYVNGEMIVKSDVEDIL 75

  Fly    73 --TTCVLTLFRRFSGYRPFLFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCP----FNH 131
              ||  :..::..:..:..|::..:|.|.|||...|.....:.....|...:.|.:||    ||:
  Fly    76 MHTT--MDFWKTSNQKKIKLYDGRLDACQFLKTSHRNGLFKIYVKSFKKHIHGNLSCPLRTNFNY 138

  Fly   132 DI 133
            .:
  Fly   139 TL 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 76..157 CDD:461928 13/62 (21%)
CG33642NP_001027257.1 DUF1091 79..160 CDD:461928 14/64 (22%)

Return to query results.
Submit another query.