DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33784 and CG33642

Sequence 1:NP_001027169.1 Gene:CG33784 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027257.1 Gene:CG33642 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster

Alignment Length:132 Identity:33/133 (25%)
Similarity:53/133 (40%) Gaps:27/133 (20%)


  Fly    26 LFKFKNVKC-TCYEKSFCELKRCELKV----------LGRGIVGLNLHAQVY-KLPIKS------ 72
            |..|.|..| .|.|:|| .:|..|..|          :...||.||..:.|. ::.:||      
  Fly    12 LLWFTNHICLKCEERSF-RIKMNEFAVKYKMRDLIQHIDFRIVNLNNRSYVNGEMIVKSDVEDIL 75

  Fly    73 --TTCVLTLFRRFSGYRPFLFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCP----FNH 131
              ||  :..::..:..:..|::..:|.|.|||...|.....:.....|...:.|.:||    ||:
  Fly    76 MHTT--MDFWKTSNQKKIKLYDGRLDACQFLKTSHRNGLFKIYVKSFKKHIHGNLSCPLRTNFNY 138

  Fly   132 DI 133
            .:
  Fly   139 TL 140

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 13/60 (22%)
CG33642NP_001027257.1 DUF1091 79..160 CDD:284008 14/65 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.