DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33784 and CG14491

Sequence 1:NP_001027169.1 Gene:CG33784 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_611276.1 Gene:CG14491 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster

Alignment Length:145 Identity:38/146 (26%)
Similarity:60/146 (41%) Gaps:19/146 (13%)


  Fly    29 FKNVKCTCYE-KSFCELKRCEL-KVLGRGIVGLNLHAQVYKLPIKS--TTCVLTLFRRFSGYRPF 89
            |.|..|:..: :....|.:|.| |.:.|....:.|.   :|.|:..  ....:.|.||| |....
  Fly     3 FTNCSCSSEDPEGMLSLLKCGLSKSVKRPSFNIELQ---FKKPVAKFFVNMRIVLPRRF-GDDFT 63

  Fly    90 LFNVT-VDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQMVLNDDMISKAPVPNG 153
            |||:: :|.|..|.::.:..|..|....:..|||:...||:..|:.........||   |.:|  
  Fly    64 LFNLSGIDGCSLLSNKNQIAFIQLGRKHMDRFSNIPKRCPWPKDVNYYIRGFRSDM---ATMP-- 123

  Fly   154 FYKLRFIVKTD-GVW 167
                .|..:|| .:|
  Fly   124 ----AFNFETDMNLW 134

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 23/79 (29%)
CG14491NP_611276.1 DM8 60..150 CDD:214778 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.