DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33784 and CG30050

Sequence 1:NP_001027169.1 Gene:CG33784 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_725159.2 Gene:CG30050 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster

Alignment Length:141 Identity:33/142 (23%)
Similarity:54/142 (38%) Gaps:42/142 (30%)


  Fly    41 FCELKRCELKVLGRGIVGLNLHAQVYKLPIKSTTC-----VLTLFRRFSGYRPF----------- 89
            :.|:|  ::..:|......||:.::  :|.|:.|.     ::.....|||....           
  Fly    30 YIEMK--QMDCVGNPNYFANLYCRI--IPPKNRTMEASVNIMQQLSVFSGSLRVSIPNAKKVITQ 90

  Fly    90 LFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLN-HTCPFNHDIIVNQMVLNDDMISKAPVPNG 153
            :|::|.|||..|:.|||....||:.:.:...||.. ..|||                     |.|
  Fly    91 IFDITFDVCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPF---------------------PKG 134

  Fly   154 FYKLRFIVKTD 164
            .::.|.|..||
  Fly   135 KFESRNISVTD 145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 21/90 (23%)
CG30050NP_725159.2 DM8 90..177 CDD:214778 22/78 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.