DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kay and fosl1b

Sequence 1:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:XP_009293711.1 Gene:fosl1b ZFINID:ZDB-GENE-091204-259 Length:200 Species:Danio rerio

Alignment Length:172 Identity:45/173 (26%)
Similarity:76/173 (44%) Gaps:10/173 (6%)


  Fly   321 ESEDSN---ASYNDTQMNEEQDTTDTSSAHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSSR 382
            |.|:|:   .:.|||:.:......|..::..|...:....|::.|....|  .||:.|...::..
Zfish    26 EHENSSNLLLAPNDTEDSTSSPDLDVITSSPDLQWFLQSSILSQSETTMG--TFSSFLPTSTTMF 88

  Fly   383 GSASVG---SSNANTSNTPARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTN 444
            ....:.   |.|.:.:........|...|:  :::.||.:|..:|||||:.||||||.||....:
Zfish    89 NCPCLSQCCSPNPSCNGAVGDNAEGHDDNK--HVSSEELEKIRIRRERNRVAAARCRDRRRMLID 151

  Fly   445 ELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHRATCQ 486
            .|..|.:.||.....:.:||..|...:.:||.:...|...|:
Zfish   152 TLQNETDHLEHVKTQLEEEIATLERERERLELVFEAHGPICK 193

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 23/61 (38%)
coiled coil 421..480 CDD:269869 22/59 (37%)
fosl1bXP_009293711.1 bZIP 127..188 CDD:304365 23/61 (38%)
coiled coil 128..179 CDD:269834 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000603
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23351
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.