DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kay and Batf2

Sequence 1:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_083243.1 Gene:Batf2 MGIID:1921731 Length:277 Species:Mus musculus

Alignment Length:270 Identity:58/271 (21%)
Similarity:95/271 (35%) Gaps:61/271 (23%)


  Fly   417 EEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATH 481
            |.||:..::::|:.||.|.|::...:.:.|.::.|.|||:..::||||:.|..........|..|
Mouse    17 ESQKQLKKKQKNRVAAQRSRQKHTSKADALHQQHESLEKQNHALRKEIQALQTELAGWGRTLHLH 81

  Fly   482 RATCQKIRSDMLSVVTCN--GLIAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITGMDATLNSTG 544
            ...|:         |.|:  .::.|:|........||..:...:|......|......::..:..
Mouse    82 ERLCR---------VDCDPCPVLLPSGCPIQAKQPSGQPAPLGYNGCQEQLGLFQTPGSSPRAQH 137

  Fly   545 RSNSPLDLKPAANIDSLLMHIKDEP---------------LDGAIDSGSSL-------------- 580
            .|..|...:....:.|||..:..:|               |..:..|||||              
Mouse   138 LSPGPCSHESPGLLPSLLPSLAFDPLMVRTPLAQLSPSPVLSASSPSGSSLLGSFSKLDPLIPSP 202

  Fly   581 -DQDGPPPSKR---------------ITLPPMSTMPHVHLSTILTPTGASSGSLQTPITSTAPGG 629
             ||..||...|               ..|.|..:....||..:    ..||...|....:.:|..
Mouse   203 QDQLAPPQPLRQEQPTSGRLASSDSPAALGPECSQNREHLPAL----PGSSTHWQKSSVAPSPQA 263

  Fly   630 FGSAFPVTSN 639
            . .|||:.|:
Mouse   264 L-MAFPLLSS 272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 17/61 (28%)
coiled coil 421..480 CDD:269869 16/59 (27%)
Batf2NP_083243.1 Basic motif. {ECO:0000255|PROSITE-ProRule:PRU00978} 20..42 6/22 (27%)
bZIP_BATF 28..74 CDD:269849 15/46 (33%)
coiled coil 28..74 CDD:269849 15/46 (33%)
Leucine-zipper. {ECO:0000255|PROSITE-ProRule:PRU00978} 46..67 9/21 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23351
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.